Lineage for d1jwya1 (1jwy A:36-79)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784069Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 1784070Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 1784071Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 1784104Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)
  8. 1784118Domain d1jwya1: 1jwy A:36-79 [67399]
    Other proteins in same PDB: d1jwya2, d1jwyb_
    complexed with adp, bgc, gdp, mg

Details for d1jwya1

PDB Entry: 1jwy (more details), 2.3 Å

PDB Description: crystal structure of the dynamin a gtpase domain complexed with gdp, determined as myosin fusion
PDB Compounds: (A:) myosin II heavy chain

SCOPe Domain Sequences for d1jwya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwya1 b.34.3.1 (A:36-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
fkltvsdkryiwynpdpkerdsyecgeivsetsdsftfktvdgq

SCOPe Domain Coordinates for d1jwya1:

Click to download the PDB-style file with coordinates for d1jwya1.
(The format of our PDB-style files is described here.)

Timeline for d1jwya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jwya2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jwyb_