Lineage for d1jwnd_ (1jwn D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976671Protein Hemoglobin I [46464] (2 species)
  7. 1976672Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (37 PDB entries)
  8. 1976754Domain d1jwnd_: 1jwn D: [67397]
    complexed with cmo, hem; mutant

Details for d1jwnd_

PDB Entry: 1jwn (more details), 2.1 Å

PDB Description: crystal structure of scapharca inaequivalvis hbi, i114f mutant ligated to carbon monoxide.
PDB Compounds: (D:) Globin I - Ark Shell

SCOPe Domain Sequences for d1jwnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwnd_ a.1.1.2 (D:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkfngpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d1jwnd_:

Click to download the PDB-style file with coordinates for d1jwnd_.
(The format of our PDB-style files is described here.)

Timeline for d1jwnd_: