SCOP 1.73: Domain d1jw8a_: 1jw8 A:

Lineage for d1jw8a_ (1jw8 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)

8. Domain d1jw8a_: 1jw8 A: [67376]
   complexed with cmo, hem, so4

Details for d1jw8a_

PDB Entry: 1jw8, 1.3 Å

PDB Description: 1.3 angstrom resolution crystal structure of p6 form of myoglobin

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1jw8a_:

Sequence; same for both SEQRES and ATOM records:

>d1jw8a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1jw8a_:

• d1jw8a_ first appeared in SCOP 1.59
  
• d1jw8a_ appears in SCOP 1.71
  
• d1jw8a_ appears in SCOP 1.75
  
• d1jw8a_ appears in the current release, SCOPe 2.08