SCOPe 2.04: Domain d1jvmd_: 1jvm D:

Lineage for d1jvmd_ (1jvm D:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (17 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d1jvmd_: 1jvm D: [67354]
   complexed with TBA (tetrabutylammonium) and rubidium
   complexed with rb, tba

Details for d1jvmd_

PDB Entry: 1jvm, 2.8 Å

PDB Description: kcsa potassium channel with tba (tetrabutylammonium) and rubidium

PDB Compounds: (D:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1jvmd_:

Sequence; same for both SEQRES and ATOM records:

>d1jvmd_ f.14.1.1 (D:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
vtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrg

Timeline for d1jvmd_:

• d1jvmd_ first appeared in SCOP 1.59
  
• d1jvmd_ appears in SCOPe 2.03
  
• d1jvmd_ appears in SCOPe 2.05
  
• d1jvmd_ appears in the current release, SCOPe 2.08