Lineage for d1jv6a_ (1jv6 A:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201497Family f.2.1.1: Seven-helix membrane receptors [56870] (4 proteins)
  6. 201498Protein Bacteriorhodopsin [56871] (2 species)
  7. 201503Species Halobacterium salinarum [TaxId:2242] [56873] (26 PDB entries)
  8. 201511Domain d1jv6a_: 1jv6 A: [67346]

Details for d1jv6a_

PDB Entry: 1jv6 (more details), 2 Å

PDB Description: bacteriorhodopsin d85s/f219l double mutant at 2.00 angstrom resolution

SCOP Domain Sequences for d1jv6a_:

Sequence, based on SEQRES records: (download)

>d1jv6a_ f.2.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum}
ewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygltm
vpfggeqnpiywaryaswlfttplllldlallvdadqgtilalvgadgimigtglvgalt
kvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypvv
wligsegagivplnietllfmvldvsakvglglillrsraif

Sequence, based on observed residues (ATOM records): (download)

>d1jv6a_ f.2.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum}
ewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgiywar
yaswlfttplllldlallvdadqgtilalvgadgimigtglvgaltkvysyrfvwwaist
aamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypvvwligsegagivpln
ietllfmvldvsakvglglillrsraif

SCOP Domain Coordinates for d1jv6a_:

Click to download the PDB-style file with coordinates for d1jv6a_.
(The format of our PDB-style files is described here.)

Timeline for d1jv6a_: