SCOPe 2.07: Domain d1jv5b1: 1jv5 B:306-417

Lineage for d1jv5b1 (1jv5 B:306-417)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (71 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1jv5b1: 1jv5 B:306-417 [67345]
   Other proteins in same PDB: d1jv5a_, d1jv5b2
   part of an anti-blood group A Fv

Details for d1jv5b1

PDB Entry: 1jv5, 2.2 Å

PDB Description: anti-blood group a fv

PDB Compounds: (B:) Ig chain heavy chain precursor V region

SCOPe Domain Sequences for d1jv5b1:

Sequence; same for both SEQRES and ATOM records:

>d1jv5b1 b.1.1.1 (B:306-417) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qpgaelvkpgtsvklsckasgynftsywinwvklrpgqglewigdiypgsgitnynekfk
skatltvdtssstaymqlsslasedsalyycagqygnlwfaywgqgtlvtvs

Timeline for d1jv5b1:

• d1jv5b1 first appeared in SCOP 1.59, called d1jv5b_
  
• d1jv5b1 was called d1jv5b_ in SCOPe 2.06
  
• d1jv5b1 appears in the current release, SCOPe 2.08