Lineage for d1jv5a_ (1jv5 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102023Species Anti-blood group A Fv, (human), kappa L chain [69143] (1 PDB entry)
  8. 102024Domain d1jv5a_: 1jv5 A: [67344]

Details for d1jv5a_

PDB Entry: 1jv5 (more details), 2.2 Å

PDB Description: anti-blood group a fv

SCOP Domain Sequences for d1jv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv5a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Anti-blood group A Fv, (human), kappa L chain}
diqmtqttsslsaslgdrvtiscrasqdinnylnwyqqkpdgtvkllihytsrlhsgvps
rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkleik

SCOP Domain Coordinates for d1jv5a_:

Click to download the PDB-style file with coordinates for d1jv5a_.
(The format of our PDB-style files is described here.)

Timeline for d1jv5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jv5b_