Lineage for d1jv2b3 (1jv2 B:606-690)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337891Fold d.200: Integrin beta tail domain [69686] (1 superfamily)
    alpha-beta-loop-beta(3); loop across free side of beta-sheet
  4. 337892Superfamily d.200.1: Integrin beta tail domain [69687] (1 family) (S)
  5. 337893Family d.200.1.1: Integrin beta tail domain [69688] (1 protein)
  6. 337894Protein Integrin beta tail domain [69689] (1 species)
  7. 337895Species Human (Homo sapiens) [TaxId:9606] [69690] (3 PDB entries)
  8. 337897Domain d1jv2b3: 1jv2 B:606-690 [67340]
    Other proteins in same PDB: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4, d1jv2b1, d1jv2b2, d1jv2b4, d1jv2b5
    complexed with ca, nag

Details for d1jv2b3

PDB Entry: 1jv2 (more details), 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3

SCOP Domain Sequences for d1jv2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv2b3 d.200.1.1 (B:606-690) Integrin beta tail domain {Human (Homo sapiens)}
dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv
rfqyyedssgksilyvveepecpkg

SCOP Domain Coordinates for d1jv2b3:

Click to download the PDB-style file with coordinates for d1jv2b3.
(The format of our PDB-style files is described here.)

Timeline for d1jv2b3: