Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) |
Family b.1.15.1: Integrin domains [69180] (2 proteins) |
Protein Hybrid domain of integrin beta [69183] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries) Uniprot P05106 27-466 |
Domain d1jv2b1: 1jv2 B:55-106,B:355-434 [67338] Other proteins in same PDB: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4, d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5 complexed with ca, nag |
PDB Entry: 1jv2 (more details), 3.1 Å
SCOPe Domain Sequences for d1jv2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jv2b1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]} efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf kdslivqvtfdcd
Timeline for d1jv2b1:
View in 3D Domains from same chain: (mouse over for more information) d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5 |
View in 3D Domains from other chains: (mouse over for more information) d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4 |