Lineage for d1jv2b1 (1jv2 B:55-106,B:355-434)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456074Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 456075Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 456076Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 456077Species Human (Homo sapiens) [TaxId:9606] [69184] (3 PDB entries)
  8. 456079Domain d1jv2b1: 1jv2 B:55-106,B:355-434 [67338]
    Other proteins in same PDB: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4, d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5

Details for d1jv2b1

PDB Entry: 1jv2 (more details), 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3

SCOP Domain Sequences for d1jv2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv2b1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens)}
efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd
lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf
kdslivqvtfdcd

SCOP Domain Coordinates for d1jv2b1:

Click to download the PDB-style file with coordinates for d1jv2b1.
(The format of our PDB-style files is described here.)

Timeline for d1jv2b1: