Lineage for d1jv2b1 (1jv2 B:55-106,B:355-434)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291450Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 291451Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 291452Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 291453Species Human (Homo sapiens) [TaxId:9606] [69184] (3 PDB entries)
  8. 291455Domain d1jv2b1: 1jv2 B:55-106,B:355-434 [67338]
    Other proteins in same PDB: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4, d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5
    complexed with ca, nag

Details for d1jv2b1

PDB Entry: 1jv2 (more details), 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3

SCOP Domain Sequences for d1jv2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv2b1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens)}
efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd
lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf
kdslivqvtfdcd

SCOP Domain Coordinates for d1jv2b1:

Click to download the PDB-style file with coordinates for d1jv2b1.
(The format of our PDB-style files is described here.)

Timeline for d1jv2b1: