Lineage for d1jv2a3 (1jv2 A:738-956)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658523Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 658524Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 658539Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 658540Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries)
  8. 658546Domain d1jv2a3: 1jv2 A:738-956 [67336]
    Other proteins in same PDB: d1jv2a4, d1jv2b1, d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5
    complexed with ca, nag

Details for d1jv2a3

PDB Entry: 1jv2 (more details), 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3
PDB Compounds: (A:) integrin, alpha v

SCOP Domain Sequences for d1jv2a3:

Sequence, based on SEQRES records: (download)

>d1jv2a3 b.1.15.1 (A:738-956) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikisslqttekndtvagqgerdhli
tkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhs
yslkssasfnviefpyknlpieditnstlvttnvtwgiq

Sequence, based on observed residues (ATOM records): (download)

>d1jv2a3 b.1.15.1 (A:738-956) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikissldihtlgcgvaqclkivcqv
grldrgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstl
vttnvtwgiq

SCOP Domain Coordinates for d1jv2a3:

Click to download the PDB-style file with coordinates for d1jv2a3.
(The format of our PDB-style files is described here.)

Timeline for d1jv2a3: