Lineage for d1jv2a2 (1jv2 A:599-737)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367700Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 367701Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 367707Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 367708Species Human (Homo sapiens) [TaxId:9606] [69182] (3 PDB entries)
  8. 367713Domain d1jv2a2: 1jv2 A:599-737 [67335]
    Other proteins in same PDB: d1jv2a4, d1jv2b1, d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5

Details for d1jv2a2

PDB Entry: 1jv2 (more details), 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3

SCOP Domain Sequences for d1jv2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv2a2 b.1.15.1 (A:599-737) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)}
dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr
nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq
ssnlfdkvspvvshkvdla

SCOP Domain Coordinates for d1jv2a2:

Click to download the PDB-style file with coordinates for d1jv2a2.
(The format of our PDB-style files is described here.)

Timeline for d1jv2a2: