Lineage for d1jtta_ (1jtt A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929315Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 929316Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 929333Domain d1jtta_: 1jtt A: [67282]
    Other proteins in same PDB: d1jttl_
    anti-lysozyme VHh domain
    complexed with fmt, na

Details for d1jtta_

PDB Entry: 1jtt (more details), 2.1 Å

PDB Description: degenerate interfaces in antigen-antibody complexes
PDB Compounds: (A:) Vh Single-Domain Antibody

SCOPe Domain Sequences for d1jtta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtta_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
dswgqgtqvtvss

SCOPe Domain Coordinates for d1jtta_:

Click to download the PDB-style file with coordinates for d1jtta_.
(The format of our PDB-style files is described here.)

Timeline for d1jtta_: