Lineage for d1jtpm_ (1jtp M:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714022Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 714086Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 714644Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 714653Domain d1jtpm_: 1jtp M: [67281]
    Other proteins in same PDB: d1jtpa_, d1jtpb_
    complexed with fmt, na

Details for d1jtpm_

PDB Entry: 1jtp (more details), 1.9 Å

PDB Description: degenerate interfaces in antigen-antibody complexes
PDB Compounds: (M:) Lysozyme C

SCOP Domain Sequences for d1jtpm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtpm_ d.2.1.2 (M:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOP Domain Coordinates for d1jtpm_:

Click to download the PDB-style file with coordinates for d1jtpm_.
(The format of our PDB-style files is described here.)

Timeline for d1jtpm_: