Lineage for d1jtpa_ (1jtp A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 651999Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)
  7. 652000Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (13 PDB entries)
  8. 652010Domain d1jtpa_: 1jtp A: [67278]
    Other proteins in same PDB: d1jtpl_, d1jtpm_

Details for d1jtpa_

PDB Entry: 1jtp (more details), 1.9 Å

PDB Description: degenerate interfaces in antigen-antibody complexes
PDB Compounds: (A:) Single-Domain Antibody

SCOP Domain Sequences for d1jtpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtpa_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
dswgqgtqvtvssrr

SCOP Domain Coordinates for d1jtpa_:

Click to download the PDB-style file with coordinates for d1jtpa_.
(The format of our PDB-style files is described here.)

Timeline for d1jtpa_: