Lineage for d1jtob_ (1jto B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287101Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)
  7. 287102Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (11 PDB entries)
  8. 287120Domain d1jtob_: 1jto B: [67275]
    Other proteins in same PDB: d1jtol_, d1jtom_
    anti-lysozyme VHh domain

Details for d1jtob_

PDB Entry: 1jto (more details), 2.5 Å

PDB Description: degenerate interfaces in antigen-antibody complexes

SCOP Domain Sequences for d1jtob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtob_ b.1.1.1 (B:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius)}
vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya
dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd
swgqgtqvtvss

SCOP Domain Coordinates for d1jtob_:

Click to download the PDB-style file with coordinates for d1jtob_.
(The format of our PDB-style files is described here.)

Timeline for d1jtob_: