Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Camel (Camelus dromedarius), anti-lysozyme antibody [48914] (4 PDB entries) |
Domain d1jtob_: 1jto B: [67275] Other proteins in same PDB: d1jtol_, d1jtom_ |
PDB Entry: 1jto (more details), 2.5 Å
SCOP Domain Sequences for d1jtob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtob_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-lysozyme antibody} vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd swgqgtqvtvss
Timeline for d1jtob_: