Lineage for d1jtoa_ (1jto A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546424Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)
  7. 546425Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (13 PDB entries)
  8. 546444Domain d1jtoa_: 1jto A: [67274]
    Other proteins in same PDB: d1jtol_, d1jtom_

Details for d1jtoa_

PDB Entry: 1jto (more details), 2.5 Å

PDB Description: degenerate interfaces in antigen-antibody complexes
PDB Compounds: (A:)

SCOP Domain Sequences for d1jtoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtoa_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius)}
vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya
dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd
swgqgtqvtvss

SCOP Domain Coordinates for d1jtoa_:

Click to download the PDB-style file with coordinates for d1jtoa_.
(The format of our PDB-style files is described here.)

Timeline for d1jtoa_: