SCOPe 2.08: Domain d1jthb_: 1jth B:

Lineage for d1jthb_ (1jth B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Syntaxin 1A [88908] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
   Uniprot P32851 196-259
   a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B

8. Domain d1jthb_: 1jth B: [67271]
   Other proteins in same PDB: d1jtha_, d1jthc_
   complex with SNAP25 fragments

Details for d1jthb_

PDB Entry: 1jth, 2 Å

PDB Description: crystal structure and biophysical properties of a complex between the n-terminal region of snap25 and the snare region of syntaxin 1a

PDB Compounds: (B:) syntaxin 1a

SCOPe Domain Sequences for d1jthb_:

Sequence; same for both SEQRES and ATOM records:

>d1jthb_ h.1.15.1 (B:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd
tkkavky

Timeline for d1jthb_:

• d1jthb_ first appeared in SCOP 1.59
  
• d1jthb_ appears in SCOPe 2.07