Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) tetrameric parallel coiled coil |
Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
Protein Syntaxin 1A [88908] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries) Uniprot P32851 196-259 a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B |
Domain d1jthb_: 1jth B: [67271] Other proteins in same PDB: d1jtha_, d1jthc_ complex with SNAP25 fragments |
PDB Entry: 1jth (more details), 2 Å
SCOPe Domain Sequences for d1jthb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jthb_ h.1.15.1 (B:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]} alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd tkkavky
Timeline for d1jthb_: