Lineage for d1jt9a_ (1jt9 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121534Fold c.35: Glucosamine 6-phosphate deaminase/isomerase [52511] (1 superfamily)
  4. 121535Superfamily c.35.1: Glucosamine 6-phosphate deaminase/isomerase [52512] (1 family) (S)
  5. 121536Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein)
  6. 121537Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species)
  7. 121538Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 121544Domain d1jt9a_: 1jt9 A: [67259]

Details for d1jt9a_

PDB Entry: 1jt9 (more details), 2.06 Å

PDB Description: structure of the mutant f174a t form of the glucosamine-6-phosphate deaminase from e.coli

SCOP Domain Sequences for d1jt9a_:

Sequence, based on SEQRES records: (download)

>d1jt9a_ c.35.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrfadndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

Sequence, based on observed residues (ATOM records): (download)

>d1jt9a_ c.35.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlpkyaltvgvgtlldaeev
milvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcdepstmelkvktlryfnele
aenikgl

SCOP Domain Coordinates for d1jt9a_:

Click to download the PDB-style file with coordinates for d1jt9a_.
(The format of our PDB-style files is described here.)

Timeline for d1jt9a_: