SCOPe 2.07: Domain d1jt3b1: 1jt3 B:1G-137

Lineage for d1jt3b1 (1jt3 B:1G-137)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1jt3b1: 1jt3 B:1G-137 [67242]
   Other proteins in same PDB: d1jt3a2, d1jt3b2
   complexed with so4

Details for d1jt3b1

PDB Entry: 1jt3, 1.95 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino histidine tag and leu 73 replaced by val (l73v)

PDB Compounds: (B:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1jt3b1:

Sequence; same for both SEQRES and ATOM records:

>d1jt3b1 b.42.1.1 (B:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
tgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
prthygqkailflplpv

Timeline for d1jt3b1:

• d1jt3b1 first appeared in SCOP 1.59, called d1jt3b_
  
• d1jt3b1 appears in SCOPe 2.06
  
• d1jt3b1 appears in the current release, SCOPe 2.08