Lineage for d1jskc_ (1jsk C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198711Protein NK cell ligand RAE-1 beta [69683] (1 species)
  7. 1198712Species Mouse (Mus musculus) [TaxId:10090] [69684] (2 PDB entries)
  8. 1198718Domain d1jskc_: 1jsk C: [67232]
    Other proteins in same PDB: d1jska_, d1jskb_

Details for d1jskc_

PDB Entry: 1jsk (more details), 3.5 Å

PDB Description: crystal structure of murine nk cell ligand rae-1 beta in complex with nkg2d
PDB Compounds: (C:) Rae-1 beta

SCOPe Domain Sequences for d1jskc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jskc_ d.19.1.1 (C:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]}
dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek

SCOPe Domain Coordinates for d1jskc_:

Click to download the PDB-style file with coordinates for d1jskc_.
(The format of our PDB-style files is described here.)

Timeline for d1jskc_: