Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein NK cell ligand RAE-1 beta [69683] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [69684] (2 PDB entries) |
Domain d1jskc_: 1jsk C: [67232] Other proteins in same PDB: d1jska_, d1jskb_ |
PDB Entry: 1jsk (more details), 3.5 Å
SCOP Domain Sequences for d1jskc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jskc_ d.19.1.1 (C:) NK cell ligand RAE-1 beta {Mouse (Mus musculus)} dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
Timeline for d1jskc_: