Lineage for d1jsca3 (1jsc A:461-648)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312976Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 312977Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 313084Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (5 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 313085Protein Acetohydroxyacid synthase catalytic subunit [88758] (1 species)
  7. 313086Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (2 PDB entries)
  8. 313087Domain d1jsca3: 1jsc A:461-648 [67226]
    Other proteins in same PDB: d1jsca1, d1jsca2, d1jscb1, d1jscb2

Details for d1jsca3

PDB Entry: 1jsc (more details), 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

SCOP Domain Sequences for d1jsca3:

Sequence, based on SEQRES records: (download)

>d1jsca3 c.36.1.9 (A:461-648) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkk

Sequence, based on observed residues (ATOM records): (download)

>d1jsca3 c.36.1.9 (A:461-648) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnnees
hthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllevevdkk

SCOP Domain Coordinates for d1jsca3:

Click to download the PDB-style file with coordinates for d1jsca3.
(The format of our PDB-style files is described here.)

Timeline for d1jsca3: