SCOPe 2.06: Domain d1js2d1: 1js2 D:305-389

Lineage for d1js2d1 (1js2 D:305-389)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family)

5. Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)

6. Protein HIPIP (high potential iron protein) [57654] (9 species)

7. Species Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId:1049] [57656] (8 PDB entries)

8. Domain d1js2d1: 1js2 D:305-389 [67214]
   Other proteins in same PDB: d1js2a2, d1js2b2, d1js2c2, d1js2d2
   complexed with sf4

Details for d1js2d1

PDB Entry: 1js2, 1.9 Å

PDB Description: crystal structure of c77s hipip: a serine ligated [4fe-4s] cluster

PDB Compounds: (D:) high-potential iron protein

SCOPe Domain Sequences for d1js2d1:

Sequence; same for both SEQRES and ATOM records:

>d1js2d1 g.35.1.1 (D:305-389) HIPIP (high potential iron protein) {Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId: 1049]}
sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
kgcqlfpgklinvngwsaswtlkag

Timeline for d1js2d1:

• d1js2d1 first appeared in SCOP 1.59, called d1js2d_
  
• d1js2d1 was called d1js2d_ in SCOPe 2.05
  
• d1js2d1 appears in SCOPe 2.07
  
• d1js2d1 appears in the current release, SCOPe 2.08