Lineage for d1jryb1 (1jry B:1-102)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347351Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2347385Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)
  7. 2347386Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries)
  8. 2347397Domain d1jryb1: 1jry B:1-102 [67202]
    Other proteins in same PDB: d1jrya2, d1jrya3, d1jryb2, d1jryb3
    complexed with fad, fum, hem, na; mutant

Details for d1jryb1

PDB Entry: 1jry (more details), 2 Å

PDB Description: crystal structure of arg402lys mutant flavocytochrome c3 from shewanella frigidimarina
PDB Compounds: (B:) flavocytochrome c

SCOPe Domain Sequences for d1jryb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jryb1 a.138.1.3 (B:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

SCOPe Domain Coordinates for d1jryb1:

Click to download the PDB-style file with coordinates for d1jryb1.
(The format of our PDB-style files is described here.)

Timeline for d1jryb1: