| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
| Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species) |
| Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries) |
| Domain d1jryb1: 1jry B:1-102 [67202] Other proteins in same PDB: d1jrya2, d1jrya3, d1jryb2, d1jryb3 complexed with fad, fum, hem, na; mutant |
PDB Entry: 1jry (more details), 2 Å
SCOPe Domain Sequences for d1jryb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jryb1 a.138.1.3 (B:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde
Timeline for d1jryb1: