Lineage for d1jrpa3 (1jrp A:346-462)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728691Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 728832Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 728833Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 728863Protein Xanthine dehydrogenase chain A, domain 4 [69772] (1 species)
  7. 728864Species Rhodobacter capsulatus [TaxId:1061] [69773] (2 PDB entries)
  8. 728869Domain d1jrpa3: 1jrp A:346-462 [67163]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa4, d1jrpb1, d1jrpb2, d1jrpc1, d1jrpc2, d1jrpc4, d1jrpd1, d1jrpd2, d1jrpe1, d1jrpe2, d1jrpe4, d1jrpf1, d1jrpf2, d1jrpg1, d1jrpg2, d1jrpg4, d1jrph1, d1jrph2

Details for d1jrpa3

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
PDB Compounds: (A:) xanthine dehydrogenase, chain A

SCOP Domain Sequences for d1jrpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpa3 d.87.2.1 (A:346-462) Xanthine dehydrogenase chain A, domain 4 {Rhodobacter capsulatus [TaxId: 1061]}
pglrcyklskrfdqdisavcgclnltlkgskietariafggmagvpkraaafeaaligqd
fredtiaaalpllaqdftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp

SCOP Domain Coordinates for d1jrpa3:

Click to download the PDB-style file with coordinates for d1jrpa3.
(The format of our PDB-style files is described here.)

Timeline for d1jrpa3: