Lineage for d1jrim_ (1jri M:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373598Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 373599Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 373600Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins)
    forms homo and heteroheptameric ring structures
  6. 373601Protein Archaeal homoheptameric Sm protein [63758] (5 species)
  7. 373647Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 373695Domain d1jrim_: 1jri M: [67133]

Details for d1jrim_

PDB Entry: 1jri (more details), 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.

SCOP Domain Sequences for d1jrim_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrim_ b.38.1.1 (M:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
qrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvli
rgdnivyisrgkla

SCOP Domain Coordinates for d1jrim_:

Click to download the PDB-style file with coordinates for d1jrim_.
(The format of our PDB-style files is described here.)

Timeline for d1jrim_: