![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.38: Sm-like fold [50181] (2 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins) forms homo and heteroheptameric ring structures |
![]() | Protein Archaeal homoheptameric Sm protein [63758] (5 species) |
![]() | Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries) MTH649, smap1 |
![]() | Domain d1jril_: 1jri L: [67132] |
PDB Entry: 1jri (more details), 2.8 Å
SCOP Domain Sequences for d1jril_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jril_ b.38.1.1 (L:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum} vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt vlirgdnivyisrgkl
Timeline for d1jril_: