Lineage for d1jrii_ (1jri I:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462478Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 462479Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 462480Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins)
    forms homo and heteroheptameric ring structures
  6. 462481Protein Archaeal homoheptameric Sm protein [63758] (5 species)
  7. 462527Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 462571Domain d1jrii_: 1jri I: [67129]

Details for d1jrii_

PDB Entry: 1jri (more details), 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.

SCOP Domain Sequences for d1jrii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrii_ b.38.1.1 (I:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
qrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvli
rgdnivyisrgk

SCOP Domain Coordinates for d1jrii_:

Click to download the PDB-style file with coordinates for d1jrii_.
(The format of our PDB-style files is described here.)

Timeline for d1jrii_: