SCOP 1.59: Domain d1jrii_: 1jri I:

Lineage for d1jrii_ (1jri I:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)

4. Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)

6. Protein Archaeal homoheptameric Sm protein [63758] (3 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (2 PDB entries)

8. Domain d1jrii_: 1jri I: [67129]

Details for d1jrii_

PDB Entry: 1jri, 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.

SCOP Domain Sequences for d1jrii_:

Sequence; same for both SEQRES and ATOM records:

>d1jrii_ b.38.1.1 (I:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
qrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvli
rgdnivyisrgk

Timeline for d1jrii_:

• d1jrii_ is new in SCOP 1.59
  
• d1jrii_ appears in SCOP 1.61
  
• d1jrii_ appears in the current release, SCOPe 2.08, called d1jrii1