Lineage for d1jric1 (1jri C:9-81)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2786773Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2786819Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 2786857Domain d1jric1: 1jri C:9-81 [67123]
    Other proteins in same PDB: d1jria2, d1jrib2, d1jric2, d1jrid2, d1jrie2, d1jrif2, d1jrig2, d1jrih2, d1jrii2, d1jril2, d1jrim2, d1jrin2
    complexed with cl, edo

Details for d1jric1

PDB Entry: 1jri (more details), 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.
PDB Compounds: (C:) Sm-like Archaeal Protein 1 (SmAP1)

SCOPe Domain Sequences for d1jric1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jric1 b.38.1.1 (C:9-81) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt
vlirgdnivyisr

SCOPe Domain Coordinates for d1jric1:

Click to download the PDB-style file with coordinates for d1jric1.
(The format of our PDB-style files is described here.)

Timeline for d1jric1: