Lineage for d1jqja3 (1jqj A:245-366)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196753Fold d.131: DNA clamp [55978] (1 superfamily)
  4. 196754Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 196755Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
  6. 196756Protein DNA polymerase III, beta subunit [55981] (1 species)
  7. 196757Species Escherichia coli [TaxId:562] [55982] (3 PDB entries)
  8. 196769Domain d1jqja3: 1jqj A:245-366 [67093]
    Other proteins in same PDB: d1jqjc1, d1jqjc2, d1jqjd1, d1jqjd2

Details for d1jqja3

PDB Entry: 1jqj (more details), 2.9 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of the beta-delta complex

SCOP Domain Sequences for d1jqja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqja3 d.131.1.1 (A:245-366) DNA polymerase III, beta subunit {Escherichia coli}
rrvlpknpdkhleagcdllkqafaraaaasnekfrgvrlyvsenqlkitannpeqeeaee
ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm
rl

SCOP Domain Coordinates for d1jqja3:

Click to download the PDB-style file with coordinates for d1jqja3.
(The format of our PDB-style files is described here.)

Timeline for d1jqja3: