Lineage for d1jqaa_ (1jqa A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953870Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 1953871Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 1953901Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 1953908Protein Glycerol dehydrogenase [69893] (2 species)
  7. 1953909Species Bacillus stearothermophilus [TaxId:1422] [69894] (3 PDB entries)
  8. 1953912Domain d1jqaa_: 1jqa A: [67085]
    complexed with gol, zn

Details for d1jqaa_

PDB Entry: 1jqa (more details), 2.05 Å

PDB Description: Bacillus stearothermophilus glycerol dehydrogenase complex with glycerol
PDB Compounds: (A:) glycerol dehydrogenase

SCOPe Domain Sequences for d1jqaa_:

Sequence, based on SEQRES records: (download)

>d1jqaa_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
aervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaae
evvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaast
daptsalsviysddgvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvear
sviksggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantll
sglgfesgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryiel
ylcldlpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqyak
aykek

Sequence, based on observed residues (ATOM records): (download)

>d1jqaa_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
aervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaae
evvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaast
daptsalsviyvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvearsvik
sggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantllsglg
fesgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryielylcl
dlpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqyakayke
k

SCOPe Domain Coordinates for d1jqaa_:

Click to download the PDB-style file with coordinates for d1jqaa_.
(The format of our PDB-style files is described here.)

Timeline for d1jqaa_: