Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (2 species) |
Species Streptomyces coelicolor [TaxId:1902] [56902] (17 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
Domain d1jq2b_: 1jq2 B: [67076] open gate model, residues 86-119; CA-atoms only |
PDB Entry: 1jq2 (more details)
SCOPe Domain Sequences for d1jq2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jq2b_ f.14.1.1 (B:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} lwgrcvavvvmvagitsfglvtaalatwfvgreq
Timeline for d1jq2b_: