Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (3 species) |
Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
Domain d1jq1b_: 1jq1 B: [67072] open gate model, residues 86-119; CA-atoms only fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1jq1 (more details)
SCOPe Domain Sequences for d1jq1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jq1b_ f.14.1.1 (B:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} lwgrcvavvvmvagitsfglvtaalatwfvgreq
Timeline for d1jq1b_: