Lineage for d1jpua_ (1jpu A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953870Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 1953871Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 1953901Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 1953908Protein Glycerol dehydrogenase [69893] (2 species)
  7. 1953909Species Bacillus stearothermophilus [TaxId:1422] [69894] (3 PDB entries)
  8. 1953911Domain d1jpua_: 1jpu A: [67055]
    complexed with zn

Details for d1jpua_

PDB Entry: 1jpu (more details), 1.8 Å

PDB Description: Crystal Structure of Bacillus Stearothermophilus Glycerol Dehydrogenase
PDB Compounds: (A:) glycerol dehydrogenase

SCOPe Domain Sequences for d1jpua_:

Sequence, based on SEQRES records: (download)

>d1jpua_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
aervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaae
evvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaast
daptsalsviysddgvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvear
sviksggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantll
sglgfesgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryiel
ylcldlpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqyak
aykekh

Sequence, based on observed residues (ATOM records): (download)

>d1jpua_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
aervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaae
evvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaast
daptsalsvgvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvearsviks
ggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantllsglgf
esgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryielylcld
lpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqyakaykek
h

SCOPe Domain Coordinates for d1jpua_:

Click to download the PDB-style file with coordinates for d1jpua_.
(The format of our PDB-style files is described here.)

Timeline for d1jpua_: