Lineage for d1jpua_ (1jpu A:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141493Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
  4. 141494Superfamily e.22.1: Dehydroquinate synthase-like [56796] (2 families) (S)
  5. 141500Family e.22.1.2: Glycerol dehydrogenase [69892] (1 protein)
  6. 141501Protein Glycerol dehydrogenase [69893] (2 species)
  7. 141502Species Bacillus stearothermophilus [TaxId:1422] [69894] (3 PDB entries)
  8. 141504Domain d1jpua_: 1jpu A: [67055]

Details for d1jpua_

PDB Entry: 1jpu (more details), 1.8 Å

PDB Description: Crystal Structure of Bacillus Stearothermophilus Glycerol Dehydrogenase

SCOP Domain Sequences for d1jpua_:

Sequence, based on SEQRES records: (download)

>d1jpua_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus}
aervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaae
evvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaast
daptsalsviysddgvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvear
sviksggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantll
sglgfesgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryiel
ylcldlpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqyak
aykekh

Sequence, based on observed residues (ATOM records): (download)

>d1jpua_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus}
aervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaae
evvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaast
daptsalsvgvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvearsviks
ggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantllsglgf
esgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryielylcld
lpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqyakaykek
h

SCOP Domain Coordinates for d1jpua_:

Click to download the PDB-style file with coordinates for d1jpua_.
(The format of our PDB-style files is described here.)

Timeline for d1jpua_: