Lineage for d1jptl1 (1jpt L:1-107)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363426Species Engineered (including hybrid species) [88533] (27 PDB entries)
  8. 363427Domain d1jptl1: 1jpt L:1-107 [67053]
    Other proteins in same PDB: d1jpth1, d1jpth2, d1jptl2
    part of humanized Fab D3H44 against human tissue factor

Details for d1jptl1

PDB Entry: 1jpt (more details), 1.85 Å

PDB Description: crystal structure of fab d3h44

SCOP Domain Sequences for d1jptl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jptl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveik

SCOP Domain Coordinates for d1jptl1:

Click to download the PDB-style file with coordinates for d1jptl1.
(The format of our PDB-style files is described here.)

Timeline for d1jptl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jptl2