![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
![]() | Species Anti-human tissue humanised factor Fab D3H44 [69136] (2 PDB entries) |
![]() | Domain d1jptl1: 1jpt L:1-107 [67053] Other proteins in same PDB: d1jpth2, d1jptl2 |
PDB Entry: 1jpt (more details), 1.85 Å
SCOP Domain Sequences for d1jptl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jptl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue humanised factor Fab D3H44} diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveik
Timeline for d1jptl1: