SCOPe 2.04: Domain d1jpth2: 1jpt H:118-217

Lineage for d1jpth2 (1jpt H:118-217)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1jpth2: 1jpt H:118-217 [67052]
   Other proteins in same PDB: d1jpth1, d1jptl1, d1jptl2
   part of humanized Fab D3H44 against human tissue factor

Details for d1jpth2

PDB Entry: 1jpt, 1.85 Å

PDB Description: crystal structure of fab d3h44

PDB Compounds: (H:) immunoglobulin Fab D3H44, heavy chain

SCOPe Domain Sequences for d1jpth2:

Sequence, based on SEQRES records:

>d1jpth2 b.1.1.2 (H:118-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d1jpth2 b.1.1.2 (H:118-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1jpth2:

• d1jpth2 first appeared in SCOP 1.59
  
• d1jpth2 appears in SCOPe 2.03
  
• d1jpth2 appears in SCOPe 2.05
  
• d1jpth2 appears in the current release, SCOPe 2.08