Lineage for d1jpst2 (1jps T:107-211)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 366660Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 366661Family b.1.2.1: Fibronectin type III [49266] (22 proteins)
  6. 366713Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 366714Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)
  8. 366718Domain d1jpst2: 1jps T:107-211 [67050]
    Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl1, d1jpsl2

Details for d1jpst2

PDB Entry: 1jps (more details), 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

SCOP Domain Sequences for d1jpst2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpst2 b.1.2.1 (T:107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

SCOP Domain Coordinates for d1jpst2:

Click to download the PDB-style file with coordinates for d1jpst2.
(The format of our PDB-style files is described here.)

Timeline for d1jpst2: