Lineage for d1jpst1 (1jps T:5-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521340Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 1521341Species Human (Homo sapiens) [TaxId:9606] [49268] (32 PDB entries)
    Uniprot P13726 33-242
  8. 1521349Domain d1jpst1: 1jps T:5-106 [67049]
    Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl1, d1jpsl2

Details for d1jpst1

PDB Entry: 1jps (more details), 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1jpst1:

Sequence, based on SEQRES records: (download)

>d1jpst1 b.1.2.1 (T:5-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1jpst1 b.1.2.1 (T:5-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnveplyenspeftpylet

SCOPe Domain Coordinates for d1jpst1:

Click to download the PDB-style file with coordinates for d1jpst1.
(The format of our PDB-style files is described here.)

Timeline for d1jpst1: