| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (28 proteins) Pfam 00041 |
| Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
| Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries) |
| Domain d1jpst1: 1jps T:5-106 [67049] Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl1, d1jpsl2 |
PDB Entry: 1jps (more details), 1.85 Å
SCOP Domain Sequences for d1jpst1:
Sequence, based on SEQRES records: (download)
>d1jpst1 b.1.2.1 (T:5-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnvestgsageplyenspeftpylet
>d1jpst1 b.1.2.1 (T:5-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnveplyenspeftpylet
Timeline for d1jpst1:
View in 3DDomains from other chains: (mouse over for more information) d1jpsh1, d1jpsh2, d1jpsl1, d1jpsl2 |