| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
| Domain d1jpsl2: 1jps L:108-213 [67048] Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl1, d1jpst1, d1jpst2 part of humanized Fab D3H44 against human tissue factor |
PDB Entry: 1jps (more details), 1.85 Å
SCOP Domain Sequences for d1jpsl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpsl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d1jpsl2:
View in 3DDomains from other chains: (mouse over for more information) d1jpsh1, d1jpsh2, d1jpst1, d1jpst2 |