SCOP 1.73: Domain d1jpsl1: 1jps L:1-107

Lineage for d1jpsl1 (1jps L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (52 PDB entries)

8. Domain d1jpsl1: 1jps L:1-107 [67047]
   Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl2, d1jpst1, d1jpst2
   part of humanized Fab D3H44 against human tissue factor

Details for d1jpsl1

PDB Entry: 1jps, 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

PDB Compounds: (L:) immunoglobulin Fab D3h44, light chain

SCOP Domain Sequences for d1jpsl1:

Sequence; same for both SEQRES and ATOM records:

>d1jpsl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveik

Timeline for d1jpsl1:

• d1jpsl1 first appeared in SCOP 1.59
  
• d1jpsl1 appears in SCOP 1.71
  
• d1jpsl1 appears in SCOP 1.75
  
• d1jpsl1 appears in the current release, SCOPe 2.08