Lineage for d1jpsl1 (1jps L:1-107)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102104Species Anti-human tissue humanised factor Fab D3H44 [69136] (2 PDB entries)
  8. 102108Domain d1jpsl1: 1jps L:1-107 [67047]
    Other proteins in same PDB: d1jpsh2, d1jpsl2, d1jpst1, d1jpst2

Details for d1jpsl1

PDB Entry: 1jps (more details), 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

SCOP Domain Sequences for d1jpsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpsl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue humanised factor Fab D3H44}
diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveik

SCOP Domain Coordinates for d1jpsl1:

Click to download the PDB-style file with coordinates for d1jpsl1.
(The format of our PDB-style files is described here.)

Timeline for d1jpsl1: