Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) |
Family a.118.9.2: VHS domain [48468] (6 proteins) |
Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries) |
Domain d1jplc1: 1jpl C:1-156 [67029] Other proteins in same PDB: d1jpla2, d1jplb2, d1jplc2, d1jpld2 complexed with peptide from cation-independent mannose 6-phosphate receptor |
PDB Entry: 1jpl (more details), 2.4 Å
SCOPe Domain Sequences for d1jplc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jplc1 a.118.9.2 (C:1-156) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} maeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqew ealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellys wtmalpeeakikdayhmlkrqgivqsdppipvdrtl
Timeline for d1jplc1: